RNASET2 anticorps (Middle Region)
-
- Antigène Voir toutes RNASET2 Anticorps
- RNASET2 (Ribonuclease T2 (RNASET2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RNASET2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RNASET2 antibody was raised against the middle region of RNASET2
- Purification
- Affinity purified
- Immunogène
- RNASET2 antibody was raised using the middle region of RNASET2 corresponding to a region with amino acids RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI
- Top Product
- Discover our top product RNASET2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RNASET2 Blocking Peptide, catalog no. 33R-8208, is also available for use as a blocking control in assays to test for specificity of this RNASET2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASET2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RNASET2 (Ribonuclease T2 (RNASET2))
- Autre désignation
- RNASET2 (RNASET2 Produits)
- Synonymes
- anticorps RNASE6PL, anticorps bA514O12.3, anticorps MGC83874, anticorps MGC145364, anticorps dre2, anticorps wu:fc10c06, anticorps zgc:113369, anticorps ribonuclease T2, anticorps ribonuclease T2 L homeolog, anticorps ribonuclease t2, anticorps RNASET2, anticorps Rnaset2, anticorps rnaset2.L, anticorps rnaset2, anticorps TM1040_2631, anticorps RPE_1409, anticorps Bind_1696, anticorps Dd586_2225, anticorps Nhal_0810, anticorps Snov_2442, anticorps Fbal_2689, anticorps Nitsa_0808, anticorps Mesop_3495
- Sujet
- This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement.
- Poids moléculaire
- 29 kDa (MW of target protein)
-