Tel:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@anticorps-enligne.fr

RNASET2 anticorps (Ribonuclease T2) (Middle Region) Primary Antibody

RNASET2 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN633593
$647.32
Plus shipping costs $45.00
50 μg
local_shipping Destination: Etats-Unis
Envoi sous 9 à 11 jours ouvrables
  • Antigène
    RNASET2
    Épitope
    Middle Region
    • 15
    • 15
    • 9
    • 5
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Reactivité
    Humain
    • 47
    • 19
    • 19
    • 1
    • 1
    • 1
    Hôte
    Lapin
    Clonalité
    Polyclonal
    Conjugué
    Cet anticorp RNASET2 est non-conjugé
    • 18
    • 7
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Western Blotting (WB)
    • 37
    • 21
    • 21
    • 13
    • 9
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Specificité
    RNASET2 antibody was raised against the middle region of RNASET2
    Purification
    Affinity purified
    Immunogène
    RNASET2 antibody was raised using the middle region of RNASET2 corresponding to a region with amino acids RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI
  • Indications d'application
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Commentaires

    RNASET2 Blocking Peptide, catalog no. 33R-8208, is also available for use as a blocking control in assays to test for specificity of this RNASET2 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASET2 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Conseil sur la manipulation
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Stock
    4 °C
    Stockage commentaire
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Antigène
    RNASET2
    Autre désignation
    RNASET2 (RNASET2 Antibody Extrait)
    Synonymes
    RNASE6PL, bA514O12.3, MGC83874, MGC145364, dre2, wu:fc10c06, zgc:113369, ribonuclease T2, ribonuclease T2 L homeolog, ribonuclease t2, RNASET2, Rnaset2, rnaset2.L, rnaset2, TM1040_2631, RPE_1409, Bind_1696, Dd586_2225, Nhal_0810, Snov_2442, Fbal_2689, Nitsa_0808, Mesop_3495
    Sujet
    This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement.
    Poids moléculaire
    29 kDa (MW of target protein)
Vous êtes ici:
help Support technique