SHROOM2 anticorps (Middle Region)

N° du produit ABIN633652

Cet anticorps Lapin Polyclonal détecte spécifiquement SHROOM2 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour SHROOM2 anticorps (Middle Region) (ABIN633652)

Antigène: SHROOM2 (Shroom Family Member 2 (SHROOM2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SHROOM2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SHROOM2 anticorps

Épitope: Middle Region

Specificité: SHROOM2 antibody was raised against the middle region of SHROOM2

Purification: Affinity purified

Immunogène: SHROOM2 antibody was raised using the middle region of SHROOM2 corresponding to a region with amino acids CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SHROOM2 Blocking Peptide, (ABIN937210), is also available for use as a blocking control in assays to test for specificity of this SHROOM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHROOM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SHROOM2

Antigène: SHROOM2 (Shroom Family Member 2 (SHROOM2))

Autre désignation: SHROOM2

Sujet: SHROOM2 shares significant similarities with the apical protein from Xenopus laevis which is implicated in amiloride-sensitive sodium channel activity. This gene is a strong candidate gene for ocular albinism type 1 syndrome.

Poids moléculaire: 176 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Asymmetric Protein Localization