KCNIP2 anticorps (N-Term)

N° du produit ABIN633671

Détail du produit anti-KCNIP2 anticorps

Antigène: KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNIP2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: KCNIP2 antibody was raised against the N terminal of KCNIP2

Purification: Affinity purified

Immunogène: KCNIP2 antibody was raised using the N terminal of KCNIP2 corresponding to a region with amino acids QLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNPGALS

Information d'application

Indications d'application: WB: 0.06 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNIP2 Blocking Peptide, catalog no. 33R-7647, is also available for use as a blocking control in assays to test for specificity of this KCNIP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNIP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNIP2

Antigène: KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))

Autre désignation: KCNIP2 (KCNIP2 Produits)

Synonymes: anticorps KCHIP2, anticorps KCNIP2, anticorps Kchip2, anticorps KChIP2, anticorps kchip2, anticorps si:ch73-173h19.2, anticorps potassium voltage-gated channel interacting protein 2, anticorps Kv channel-interacting protein 2, anticorps Kv channel interacting protein 2 S homeolog, anticorps Kv channel interacting protein 2, anticorps KCNIP2, anticorps Kcnip2, anticorps kcnip2.S, anticorps kcnip2

Sujet: KCNIP2 encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium.

Poids moléculaire: 21 kDa (MW of target protein)