ACCN1 anticorps

N° du produit ABIN633674

L’anticorps Lapin Polyclonal anti-ACCN1 a été validé pour WB. Il convient pour détecter ACCN1 dans des échantillons de Humain et Chien.

Aperçu rapide pour ACCN1 anticorps (ABIN633674)

Antigène: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACCN1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ACCN1 anticorps

Purification: Affinity purified

Immunogène: ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV

Information d'application

Indications d'application: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACCN1 Blocking Peptide, (ABIN938583), is also available for use as a blocking control in assays to test for specificity of this ACCN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACCN1

Antigène: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Autre désignation: ACCN1

Sujet: ACCN1 is a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. ACCN1 may play a role in neurotransmission. In addition, a heteromeric association between ACCN1 and ACCN3 (variant 1) has been observed to co-assemble into proton-gated channels sensitive to gadolinium.

Poids moléculaire: 63 kDa (MW of target protein)

Pathways: Sensory Perception of Sound