ACCN1 anticorps
-
- Antigène Voir toutes ACCN1 Anticorps
- ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACCN1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV
- Top Product
- Discover our top product ACCN1 Anticorps primaire
-
-
- Indications d'application
-
WB: 2 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACCN1 Blocking Peptide, catalog no. 33R-3197, is also available for use as a blocking control in assays to test for specificity of this ACCN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))
- Autre désignation
- ACCN1 (ACCN1 Produits)
- Synonymes
- anticorps ACCN, anticorps ACCN1, anticorps ASIC2a, anticorps BNC1, anticorps BNaC1, anticorps MDEG, anticorps hBNaC1, anticorps ACIC2, anticorps Accn1, anticorps BNaC1a, anticorps Mdeg, anticorps BNC1k, anticorps MDEG1, anticorps MDEG2, anticorps accn1, anticorps zASIC2, anticorps acid sensing ion channel subunit 2, anticorps acid-sensing (proton-gated) ion channel 2, anticorps ASIC2, anticorps Asic2, anticorps asic2
- Sujet
- ACCN1 is a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. ACCN1 may play a role in neurotransmission. In addition, a heteromeric association between ACCN1 and ACCN3 (variant 1) has been observed to co-assemble into proton-gated channels sensitive to gadolinium.
- Poids moléculaire
- 63 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-