KCNV2 anticorps (N-Term)

N° du produit ABIN633692

L’anticorps anti-KCNV2 Polyclonal Lapin est utilisé pour la détection de KCNV2 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour KCNV2 anticorps (N-Term) (ABIN633692)

Antigène: KCNV2 (Potassium Channel, Subfamily V, Member 2 (KCNV2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNV2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KCNV2 anticorps

Épitope: N-Term

Specificité: KCNV2 antibody was raised against the N terminal of KCNV2

Purification: Affinity purified

Immunogène: KCNV2 antibody was raised using the N terminal of KCNV2 corresponding to a region with amino acids RSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNV2 Blocking Peptide, (ABIN5614300), is also available for use as a blocking control in assays to test for specificity of this KCNV2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNV2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNV2

Antigène: KCNV2 (Potassium Channel, Subfamily V, Member 2 (KCNV2))

Autre désignation: KCNV2

Sujet: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.

Poids moléculaire: 62 kDa (MW of target protein)