KCNV2 anticorps (N-Term)
-
- Antigène Voir toutes KCNV2 Anticorps
- KCNV2 (Potassium Channel, Subfamily V, Member 2 (KCNV2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNV2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCNV2 antibody was raised against the N terminal of KCNV2
- Purification
- Affinity purified
- Immunogène
- KCNV2 antibody was raised using the N terminal of KCNV2 corresponding to a region with amino acids RSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAK
- Top Product
- Discover our top product KCNV2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNV2 Blocking Peptide, catalog no. 33R-8183, is also available for use as a blocking control in assays to test for specificity of this KCNV2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNV2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCNV2 (Potassium Channel, Subfamily V, Member 2 (KCNV2))
- Autre désignation
- KCNV2 (KCNV2 Produits)
- Synonymes
- anticorps KV11.1, anticorps Kv8.2, anticorps RCD3B, anticorps potassium voltage-gated channel modifier subfamily V member 2, anticorps potassium channel, subfamily V, member 2, anticorps KCNV2, anticorps Kcnv2
- Sujet
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.
- Poids moléculaire
- 62 kDa (MW of target protein)
-