CHRNA3 anticorps (N-Term)

N° du produit ABIN633761

L’anticorps anti-CHRNA3 Polyclonal Lapin est utilisé pour la détection de CHRNA3 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour CHRNA3 anticorps (N-Term) (ABIN633761)

Antigène: CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHRNA3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CHRNA3 anticorps

Épitope: N-Term

Specificité: CHRNA3 antibody was raised against the N terminal of CHRNA3

Purification: Affinity purified

Immunogène: CHRNA3 antibody was raised using the N terminal of CHRNA3 corresponding to a region with amino acids EHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHRNA3 Blocking Peptide, (ABIN937844), is also available for use as a blocking control in assays to test for specificity of this CHRNA3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHRNA3

Antigène: CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))

Autre désignation: CHRNA3

Sujet: The CHRNA3 subunit is expressed in the soma of the majority of pyramidal cells, with the most alpha 3 immunoreactivity observed in CA2-4 and entorhinal cortex and relatively less in CA1 and subicular pyramidal cell soma.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Synaptic Membrane