CHRNA3 anticorps (N-Term)
-
- Antigène Voir toutes CHRNA3 Anticorps
- CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHRNA3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CHRNA3 antibody was raised against the N terminal of CHRNA3
- Purification
- Affinity purified
- Immunogène
- CHRNA3 antibody was raised using the N terminal of CHRNA3 corresponding to a region with amino acids EHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETN
- Top Product
- Discover our top product CHRNA3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHRNA3 Blocking Peptide, catalog no. 33R-2458, is also available for use as a blocking control in assays to test for specificity of this CHRNA3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))
- Autre désignation
- CHRNA3 (CHRNA3 Produits)
- Synonymes
- anticorps LNCR2, anticorps NACHRA3, anticorps PAOD2, anticorps (a)3, anticorps A730007P14Rik, anticorps Acra-3, anticorps Acra3, anticorps cholinergic receptor nicotinic alpha 3 subunit, anticorps cholinergic receptor, nicotinic, alpha polypeptide 3, anticorps CHRNA3, anticorps Chrna3
- Sujet
- The CHRNA3 subunit is expressed in the soma of the majority of pyramidal cells, with the most alpha 3 immunoreactivity observed in CA2-4 and entorhinal cortex and relatively less in CA1 and subicular pyramidal cell soma.
- Poids moléculaire
- 57 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-