GABRB3 anticorps

N° du produit ABIN633769

Cet anticorps Lapin Polyclonal détecte spécifiquement GABRB3 dans WB. Il présente une réactivité avec des échantillons de Humain, Rat et Souris.

Aperçu rapide pour GABRB3 anticorps (ABIN633769)

Antigène: GABRB3 (gamma-aminobutyric Acid (GABA) A Receptor, beta 3 (GABRB3))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GABRB3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GABRB3 anticorps

Purification: Affinity purified

Immunogène: GABRB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GABRB3 Blocking Peptide, (ABIN938138), is also available for use as a blocking control in assays to test for specificity of this GABRB3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GABRB3

Antigène: GABRB3 (gamma-aminobutyric Acid (GABA) A Receptor, beta 3 (GABRB3))

Autre désignation: GABRB3

Sujet: GABRB3 is a member of the ligand-gated ionic channel family. GABRB3 is one of at least 13 distinct subunits of a multisubunit chloride channel that serves as the receptor for gamma-aminobutyric acid, the major inhibitory transmitter of the nervous system. Mutations in this gene may be associated with the pathogenesis of Angelman syndrome, Prader-Willi syndrome, and autism.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Sensory Perception of Sound