CHRNA1 anticorps

N° du produit ABIN633770

L’anticorps anti-CHRNA1 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de CHRNA1 dans des échantillons provenant de Humain et Rat. }

Aperçu rapide pour CHRNA1 anticorps (ABIN633770)

Antigène: CHRNA1 (Acetylcholine Receptor Subunit alpha (CHRNA1))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHRNA1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CHRNA1 anticorps

Purification: Affinity purified

Immunogène: CHRNA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVD

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHRNA1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CHRNA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHRNA1

Antigène: CHRNA1 (Acetylcholine Receptor Subunit alpha (CHRNA1))

Autre désignation: CHRNA1

Sujet: The CHRNA1 gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development