TMOD2 anticorps

N° du produit ABIN633813

Détail du produit anti-TMOD2 anticorps

Antigène: TMOD2 (Tropomodulin 2 (TMOD2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMOD2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Tropomodulin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tropomodulin 2 Blocking Peptide, catalog no. 33R-6513, is also available for use as a blocking control in assays to test for specificity of this Tropomodulin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMOD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMOD2

Antigène: TMOD2 (Tropomodulin 2 (TMOD2))

Autre désignation: Tropomodulin 2 (TMOD2 Produits)

Synonymes: anticorps zgc:86648, anticorps N-Tmod, anticorps NTMOD, anticorps N-TMOD, anticorps tropomodulin 2, anticorps tmod2, anticorps Tmod2, anticorps TMOD2

Sujet: TMOD2 is a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. It caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling