JARID2 anticorps (N-Term)

N° du produit ABIN633819

Détail du produit anti-JARID2 anticorps

Antigène: JARID2 (Jumonji, AT Rich Interactive Domain 2 (JARID2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp JARID2 est non-conjugé

Application: Western Blotting (WB)

Specificité: JARID2 antibody was raised against the N terminal of JARID2

Purification: Affinity purified

Immunogène: JARID2 antibody was raised using the N terminal of JARID2 corresponding to a region with amino acids THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

JARID2 Blocking Peptide, catalog no. 33R-9106, is also available for use as a blocking control in assays to test for specificity of this JARID2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JARID2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur JARID2

Antigène: JARID2 (Jumonji, AT Rich Interactive Domain 2 (JARID2))

Autre désignation: JARID2 (JARID2 Produits)

Synonymes: anticorps JMJ, anticorps Jmj, anticorps jumonji, anticorps JARID2, anticorps jarid2, anticorps jmj, anticorps si:dkey-211c3.1, anticorps Jumonji, anticorps jarid2-a, anticorps jarid2-b, anticorps jarid2.S, anticorps jarid2b, anticorps jumonji and AT-rich interaction domain containing 2, anticorps jumonji, AT rich interactive domain 2, anticorps jumonji, AT rich interactive domain 2a, anticorps jumonji, AT rich interactive domain 2b, anticorps jumonji and AT-rich interaction domain containing 2 L homeolog, anticorps JARID2, anticorps Jarid2, anticorps jarid2a, anticorps jarid2, anticorps jarid2b, anticorps jarid2.L

Sujet: This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation.

Poids moléculaire: 139 kDa (MW of target protein)

Pathways: Chromatin Binding