Cardiotrophin 1 anticorps (N-Term)

N° du produit ABIN633827

Détail du produit anti-Cardiotrophin 1 anticorps

Antigène: Cardiotrophin 1 (CTF1)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cardiotrophin 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Cardiotrophin 1 antibody was raised against the N terminal of CTF1

Purification: Affinity purified

Immunogène: Cardiotrophin 1 antibody was raised using the N terminal of CTF1 corresponding to a region with amino acids MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQ

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cardiotrophin 1 Blocking Peptide, catalog no. 33R-6489, is also available for use as a blocking control in assays to test for specificity of this Cardiotrophin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cardiotrophin 1

Antigène: Cardiotrophin 1 (CTF1)

Autre désignation: Cardiotrophin 1 (CTF1 Produits)

Synonymes: anticorps CTF1, anticorps ct1, anticorps ct-1, anticorps ctf2, anticorps CT-1, anticorps CT1, anticorps cardiotrophin 1, anticorps cardiotrophin-1, anticorps CTF1, anticorps ctf1, anticorps Ctf1, anticorps LOC100736818

Sujet: CTF1 induces cardiac myocyte hypertrophy in vitro. It binds to and activates the ILST/gp130 receptor. It belongs to the IL-6 superfamily.

Poids moléculaire: 21 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT