SH3G2 anticorps (Middle Region)

N° du produit ABIN633831

Cet anticorps anti-SH3G2 est un anticorps Lapin Polyclonal détectant SH3G2 dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour SH3G2 anticorps (Middle Region) (ABIN633831)

Antigène: SH3G2 (Endophilin-A1 (SH3G2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SH3G2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SH3G2 anticorps

Épitope: Middle Region

Specificité: SH3 GL2 antibody was raised against the middle region of SH3 L2

Purification: Affinity purified

Immunogène: SH3 GL2 antibody was raised using the middle region of SH3 L2 corresponding to a region with amino acids PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SH3GL2 Blocking Peptide, (ABIN5616127), is also available for use as a blocking control in assays to test for specificity of this SH3GL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 L2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SH3G2

Antigène: SH3G2 (Endophilin-A1 (SH3G2))

Autre désignation: SH3GL2

Sujet: SH3GL2 is implicated in synaptic vesicle endocytosis. SH3GL2 may recruit other proteins to membranes with high curvature.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway, EGFR Downregulation