SH3G2 anticorps (Middle Region)
-
- Antigène Voir toutes SH3G2 Anticorps
- SH3G2 (Endophilin-A1 (SH3G2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SH3G2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SH3 GL2 antibody was raised against the middle region of SH3 L2
- Purification
- Affinity purified
- Immunogène
- SH3 GL2 antibody was raised using the middle region of SH3 L2 corresponding to a region with amino acids PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD
- Top Product
- Discover our top product SH3G2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SH3GL2 Blocking Peptide, catalog no. 33R-7338, is also available for use as a blocking control in assays to test for specificity of this SH3GL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 L2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SH3G2 (Endophilin-A1 (SH3G2))
- Autre désignation
- SH3GL2 (SH3G2 Produits)
- Synonymes
- anticorps CNSA2, anticorps EEN-B1, anticorps SH3D2A, anticorps SH3P4, anticorps 9530001L19Rik, anticorps AI120490, anticorps AW555077, anticorps B930049H17Rik, anticorps SH3PA, anticorps Sh3d2a, anticorps Sh3p4, anticorps SH3 domain containing GRB2 like 2, endophilin A1, anticorps SH3-domain GRB2-like 2, anticorps SH3GL2, anticorps Sh3gl2
- Sujet
- SH3GL2 is implicated in synaptic vesicle endocytosis. SH3GL2 may recruit other proteins to membranes with high curvature.
- Poids moléculaire
- 40 kDa (MW of target protein)
- Pathways
- Neurotrophin Signaling Pathway, EGFR Downregulation
-