SH3G2 anticorps (Middle Region)

N° du produit ABIN633831

Détail du produit anti-SH3G2 anticorps

Antigène: SH3G2 (Endophilin-A1 (SH3G2))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SH3G2 est non-conjugé

Application: Western Blotting (WB)

Specificité: SH3 GL2 antibody was raised against the middle region of SH3 L2

Purification: Affinity purified

Immunogène: SH3 GL2 antibody was raised using the middle region of SH3 L2 corresponding to a region with amino acids PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SH3GL2 Blocking Peptide, catalog no. 33R-7338, is also available for use as a blocking control in assays to test for specificity of this SH3GL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 L2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SH3G2

Antigène: SH3G2 (Endophilin-A1 (SH3G2))

Autre désignation: SH3GL2 (SH3G2 Produits)

Synonymes: anticorps CNSA2, anticorps EEN-B1, anticorps SH3D2A, anticorps SH3P4, anticorps 9530001L19Rik, anticorps AI120490, anticorps AW555077, anticorps B930049H17Rik, anticorps SH3PA, anticorps Sh3d2a, anticorps Sh3p4, anticorps SH3 domain containing GRB2 like 2, endophilin A1, anticorps SH3-domain GRB2-like 2, anticorps SH3GL2, anticorps Sh3gl2

Sujet: SH3GL2 is implicated in synaptic vesicle endocytosis. SH3GL2 may recruit other proteins to membranes with high curvature.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway, EGFR Downregulation