PLA2G5 anticorps (N-Term)
-
- Antigène Voir toutes PLA2G5 Anticorps
- PLA2G5 (phospholipase A2, Group V (PLA2G5))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PLA2G5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PLA2 G5 antibody was raised against the N terminal of PLA2 5
- Purification
- Affinity purified
- Immunogène
- PLA2 G5 antibody was raised using the N terminal of PLA2 5 corresponding to a region with amino acids MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW
- Top Product
- Discover our top product PLA2G5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PLA2G5 Blocking Peptide, catalog no. 33R-6140, is also available for use as a blocking control in assays to test for specificity of this PLA2G5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLA0 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PLA2G5 (phospholipase A2, Group V (PLA2G5))
- Autre désignation
- PLA2G5 (PLA2G5 Produits)
- Sujet
- This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1.
- Poids moléculaire
- 14 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-