Manic Fringe anticorps (Middle Region)
-
- Antigène Voir toutes Manic Fringe (MFNG) Anticorps
- Manic Fringe (MFNG) (MFNG)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Manic Fringe est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MFNG antibody was raised against the middle region of MFNG
- Purification
- Affinity purified
- Immunogène
- MFNG antibody was raised using the middle region of MFNG corresponding to a region with amino acids MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETL
- Top Product
- Discover our top product MFNG Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MFNG Blocking Peptide, catalog no. 33R-5720, is also available for use as a blocking control in assays to test for specificity of this MFNG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFNG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Manic Fringe (MFNG) (MFNG)
- Autre désignation
- MFNG (MFNG Produits)
- Synonymes
- anticorps AW546563, anticorps MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase, anticorps MFNG, anticorps Mfng
- Sujet
- MFNG is one of the evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. This gene is a member of the fringe gene family which also includes Radical and Lunatic fringe. They all encode evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta1,3 N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling.
- Poids moléculaire
- 36 kDa (MW of target protein)
- Pathways
- Signalisation Notch
-