Manic Fringe anticorps (C-Term)

N° du produit ABIN633865

Cet anticorps Lapin Polyclonal détecte spécifiquement Manic Fringe dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour Manic Fringe anticorps (C-Term) (ABIN633865)

Antigène: Manic Fringe (MFNG) (MFNG)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Manic Fringe est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Manic Fringe anticorps

Épitope: C-Term

Specificité: MFNG antibody was raised against the C terminal of MFNG

Purification: Affinity purified

Immunogène: MFNG antibody was raised using the C terminal of MFNG corresponding to a region with amino acids QLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYP

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MFNG Blocking Peptide, (ABIN5614739), is also available for use as a blocking control in assays to test for specificity of this MFNG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFNG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Manic Fringe

Antigène: Manic Fringe (MFNG) (MFNG)

Autre désignation: MFNG

Sujet: MFNG is one of the evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. This gene is a member of the fringe gene family which also includes Radical and Lunatic fringe. They all encode evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta1,3 N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Signalisation Notch