Endonuclease G anticorps (Middle Region)

N° du produit ABIN633888

Cet anticorps anti-Endonuclease G est un anticorps Lapin Polyclonal détectant Endonuclease G dans WB. Adapté pour Humain, Rat et Souris.

Aperçu rapide pour Endonuclease G anticorps (Middle Region) (ABIN633888)

Antigène: Endonuclease G (ENDOG)

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Endonuclease G est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Endonuclease G anticorps

Épitope: Middle Region

Specificité: ENDOG antibody was raised against the middle region of ENDOG

Purification: Affinity purified

Immunogène: ENDOG antibody was raised using the middle region of ENDOG corresponding to a region with amino acids YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ENDOG Blocking Peptide, (ABIN936261), is also available for use as a blocking control in assays to test for specificity of this ENDOG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENDOG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Endonuclease G

Antigène: Endonuclease G (ENDOG)

Autre désignation: ENDOG

Sujet: ENDOG cleaves DNA at double-stranded (DG)n.(DC)n and at single-stranded (DC)n tracts. In addition to deoxyribonuclease activities, ENDOG also has ribonuclease (RNase) and RNase H activities. ENDOG is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Apoptose