Endonuclease G anticorps (Middle Region)

N° du produit ABIN633888

Détail du produit anti-Endonuclease G anticorps

Antigène: Endonuclease G (ENDOG)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Endonuclease G est non-conjugé

Application: Western Blotting (WB)

Specificité: ENDOG antibody was raised against the middle region of ENDOG

Purification: Affinity purified

Immunogène: ENDOG antibody was raised using the middle region of ENDOG corresponding to a region with amino acids YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ENDOG Blocking Peptide, catalog no. 33R-10281, is also available for use as a blocking control in assays to test for specificity of this ENDOG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENDOG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Endonuclease G

Antigène: Endonuclease G (ENDOG)

Autre désignation: ENDOG (ENDOG Produits)

Synonymes: anticorps CG8862, anticorps Dmel\\CG8862, anticorps Tb08.10J17.140, anticorps Tb08.10J17.90, anticorps TBC1D13, anticorps endog, anticorps ENDOG, anticorps wu:fb79c08, anticorps zgc:110020, anticorps Endonuclease G, anticorps endonuclease G, anticorps putative endonuclease G, anticorps endonuclease G, mitochondrial, anticorps endonuclease G L homeolog, anticorps EndoG, anticorps Tc00.1047053506867.10, anticorps Tb927.8.4040, anticorps Tb927.8.4090, anticorps LBRM_10_0750, anticorps LMJF_10_0610, anticorps NAEGRDRAFT_78507, anticorps ENDOG, anticorps endog, anticorps eNDOG, anticorps LOC100529218, anticorps Endog, anticorps endog.L

Sujet: ENDOG cleaves DNA at double-stranded (DG)n.(DC)n and at single-stranded (DC)n tracts. In addition to deoxyribonuclease activities, ENDOG also has ribonuclease (RNase) and RNase H activities. ENDOG is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Apoptose