REG1B anticorps (N-Term)

N° du produit ABIN633906

Détail du produit anti-REG1B anticorps

Antigène: REG1B (Regenerating Islet-Derived 1 beta (REG1B))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp REG1B est non-conjugé

Application: Western Blotting (WB)

Specificité: REG1 B antibody was raised against the N terminal of REG1

Purification: Affinity purified

Immunogène: REG1 B antibody was raised using the N terminal of REG1 corresponding to a region with amino acids MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

REG1B Blocking Peptide, catalog no. 33R-5728, is also available for use as a blocking control in assays to test for specificity of this REG1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REG0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur REG1B

Antigène: REG1B (Regenerating Islet-Derived 1 beta (REG1B))

Autre désignation: REG1B (REG1B Produits)

Synonymes: anticorps PSPS2, anticorps REGH, anticorps REGI-BETA, anticorps REGL, anticorps regenerating family member 1 beta, anticorps REG1B

Sujet: REG1B might act as an inhibitor of spontaneous calcium carbonate precipitation. REG1B may be associated with neuronal sprouting in brain, and with brain and pancreas regeneration.

Poids moléculaire: 16 kDa (MW of target protein)