Glucose-6-Phosphate Dehydrogenase anticorps

N° du produit ABIN633920

Détail du produit anti-Glucose-6-Phosphate Dehydrogenase anticorps

Antigène: Glucose-6-Phosphate Dehydrogenase (G6PD)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Glucose-6-Phosphate Dehydrogenase est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: H6 PD antibody was raised using a synthetic peptide corresponding to a region with amino acids HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

H6PD Blocking Peptide, catalog no. 33R-3729, is also available for use as a blocking control in assays to test for specificity of this H6PD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of H0 D antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Glucose-6-Phosphate Dehydrogenase

Antigène: Glucose-6-Phosphate Dehydrogenase (G6PD)

Autre désignation: H6PD (G6PD Produits)

Synonymes: anticorps G6PD1, anticorps g6pd, anticorps G6pd, anticorps G6pdx, anticorps g6pdh, anticorps g6pd2, anticorps fj78b06, anticorps wu:fj78b06, anticorps si:dkey-90a13.8, anticorps BA3433, anticorps CORTRD1, anticorps G6PDH, anticorps GDH, anticorps G28A, anticorps G6PD, anticorps Gpdx, anticorps glucose-6-phosphate dehydrogenase, anticorps glucose-6-phosphate 1-dehydrogenase, anticorps glucose-6-phosphate 1-dehydrogenase (G6PD), anticorps glucose-6-P dehydrogenase, anticorps glucose-6-phosphate dehydrogenase L homeolog, anticorps glucose-6-phosphate 1-dehydrogenase Zwf, anticorps hexose-6-phosphate dehydrogenase/glucose 1-dehydrogenase, anticorps glucose-6-phosphate dehydrogenase X-linked, anticorps G6PD, anticorps g6pd, anticorps g6pD, anticorps zwf, anticorps LOC100120232, anticorps LACBIDRAFT_188936, anticorps G6pd, anticorps g6pd.L, anticorps CNG03280, anticorps Tb10.70.5200, anticorps H6PD, anticorps G6pdx, anticorps H6pd

Sujet: There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells.

Poids moléculaire: 89 kDa (MW of target protein)

Pathways: Regulation of Systemic Arterial Blood Pressure by Hormones