GSTM1 anticorps (N-Term)

N° du produit ABIN633921

Détail du produit anti-GSTM1 anticorps

Antigène: GSTM1 (Glutathione S-Transferase mu 1 (GSTM1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GSTM1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GSTM1 antibody was raised against the N terminal of GSTM1

Purification: Affinity purified

Immunogène: GSTM1 antibody was raised using the N terminal of GSTM1 corresponding to a region with amino acids KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GSTM1 Blocking Peptide, catalog no. 33R-4498, is also available for use as a blocking control in assays to test for specificity of this GSTM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GSTM1

Antigène: GSTM1 (Glutathione S-Transferase mu 1 (GSTM1))

Autre désignation: GSTM1 (GSTM1 Produits)

Synonymes: anticorps GST1, anticorps GSTM1-1, anticorps GSTM1a-1a, anticorps GSTM1b-1b, anticorps GTH4, anticorps GTM1, anticorps H-B, anticorps MU, anticorps MU-1, anticorps GSTA3, anticorps Gstb-1, anticorps Gstb1, anticorps gst-mu, anticorps gst1, anticorps gstm1, anticorps gstm2, anticorps gth4, anticorps gtm1, anticorps glutathione S-transferase mu 1, anticorps glutathione S-transferase M1, anticorps glutathione S-transferase, mu 1, anticorps glutathione S-transferase Mu 1, anticorps glutathione S-transferase mu 2 (muscle), anticorps glutathione S-transferase mu 1 L homeolog, anticorps GSTM1, anticorps Gstm1, anticorps LOC100356307, anticorps GSTM2, anticorps LOC100731426, anticorps gstm1.L

Sujet: Cytosolic and membrane-bound forms of glutathione S-transferase are two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM1 a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity