IFNA5 anticorps (Middle Region)

N° du produit ABIN633933

Détail du produit anti-IFNA5 anticorps

Antigène: IFNA5 (Interferon, alpha 5 (IFNA5))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IFNA5 est non-conjugé

Application: Western Blotting (WB)

Specificité: IFN Alpha 5 antibody was raised against the middle region of IFNA5

Purification: Affinity purified

Immunogène: IFN Alpha 5 antibody was raised using the middle region of IFNA5 corresponding to a region with amino acids TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IFN Alpha 5 Blocking Peptide, catalog no. 33R-9048, is also available for use as a blocking control in assays to test for specificity of this IFN Alpha 5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFNA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IFNA5

Antigène: IFNA5 (Interferon, alpha 5 (IFNA5))

Autre désignation: IFN alpha 5 (IFNA5 Produits)

Synonymes: anticorps IFN-alpha-5, anticorps IFN-alphaG, anticorps INA5, anticorps INFA5, anticorps leIF G, anticorps Ifa5, anticorps IFN-ALPHA-5, anticorps interferon alpha 5, anticorps interferon, alpha 5, anticorps interferon alpha family, gene 5, anticorps IFNA5, anticorps Ifna5, anticorps IFN-ALPHA-5

Sujet: Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest.

Poids moléculaire: 20 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT, Hepatitis C