IFNA5 anticorps (Middle Region)
-
- Antigène Voir toutes IFNA5 Anticorps
- IFNA5 (Interferon, alpha 5 (IFNA5))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IFNA5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- IFN Alpha 5 antibody was raised against the middle region of IFNA5
- Purification
- Affinity purified
- Immunogène
- IFN Alpha 5 antibody was raised using the middle region of IFNA5 corresponding to a region with amino acids TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY
- Top Product
- Discover our top product IFNA5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IFN Alpha 5 Blocking Peptide, catalog no. 33R-9048, is also available for use as a blocking control in assays to test for specificity of this IFN Alpha 5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFNA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IFNA5 (Interferon, alpha 5 (IFNA5))
- Autre désignation
- IFN alpha 5 (IFNA5 Produits)
- Synonymes
- anticorps IFN-alpha-5, anticorps IFN-alphaG, anticorps INA5, anticorps INFA5, anticorps leIF G, anticorps Ifa5, anticorps IFN-ALPHA-5, anticorps interferon alpha 5, anticorps interferon, alpha 5, anticorps interferon alpha family, gene 5, anticorps IFNA5, anticorps Ifna5, anticorps IFN-ALPHA-5
- Sujet
- Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest.
- Poids moléculaire
- 20 kDa (MW of target protein)
- Pathways
- Signalistation JAK/STAT, Hepatitis C
-