Decorin anticorps (N-Term)

N° du produit ABIN633940

Cet anticorps Lapin Polyclonal détecte spécifiquement Decorin dans WB. Il présente une réactivité envers Humain et Chien.

Aperçu rapide pour Decorin anticorps (N-Term) (ABIN633940)

Antigène: Decorin (DCN)

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Decorin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Decorin anticorps

Épitope: N-Term

Specificité: Decorin antibody was raised against the N terminal of DCN

Purification: Affinity purified

Immunogène: Decorin antibody was raised using the N terminal of DCN corresponding to a region with amino acids IGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Decorin Blocking Peptide, (ABIN939363), is also available for use as a blocking control in assays to test for specificity of this Decorin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Decorin

Antigène: Decorin (DCN)

Autre désignation: Decorin

Sujet: DCN is a small cellular or pericellular matrix proteoglycan that is closely related in structure to biglycan protein. This protein and biglycan are thought to be the result of a gene duplication. DCN is a component of connective tissue, binds to type I collagen fibrils, and plays a role in matrix assembly. It contains one attached glycosaminoglycan chain. This protein is capable of suppressing the growth of various tumor cell lines. There are multiple alternatively spliced transcript variants known for this gene. This gene is a candidate gene for Marfan syndrome.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process