Albumin anticorps (N-Term)

N° du produit ABIN633959

L’anticorps Lapin Polyclonal anti-Albumin a été validé pour WB. Il convient pour détecter Albumin dans des échantillons de Humain. Il y a 2+ publications disponibles.

Aperçu rapide pour Albumin anticorps (N-Term) (ABIN633959)

Antigène: Albumin (ALB)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Albumin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Albumin anticorps

Épitope: N-Term

Specificité: Albumin antibody was raised against the N terminal of ALB

Purification: Affinity purified

Immunogène: Albumin antibody was raised using the N terminal of ALB corresponding to a region with amino acids YGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Albumin Blocking Peptide, (ABIN936066), is also available for use as a blocking control in assays to test for specificity of this Albumin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-Albumin (ABIN633959)

Canuel, Bhattacharyya, Balbis, Yuan, Morales: "Sortilin and prosaposin localize to detergent-resistant membrane microdomains." dans: Experimental cell research, Vol. 315, Issue 2, pp. 240-7, (2008) (PubMed).

Clavant, Sastra, Osicka, Comper: "The analysis and characterisation of immuno-unreactive urinary albumin in healthy volunteers." dans: Clinical biochemistry, Vol. 39, Issue 2, pp. 143-51, (2006) (PubMed).

Détails sur Albumin

Antigène: Albumin (ALB)

Autre désignation: Albumin

Sujet: Albumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume. Albumin is a globular unglycosylated serum protein of molecular weight 65,000. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin.

Poids moléculaire: 66 kDa (MW of target protein)

Pathways: Lipid Metabolism