P4HB anticorps (N-Term)

N° du produit ABIN633962

L’anticorps Lapin Polyclonal anti-P4HB a été validé pour WB et IHC. Il convient pour détecter P4HB dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour P4HB anticorps (N-Term) (ABIN633962)

Antigène: P4HB (Prolyl 4-Hydroxylase, beta Polypeptide (P4HB))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp P4HB est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-P4HB anticorps

Épitope: N-Term

Specificité: P4 HB antibody was raised against the N terminal of P4 B

Purification: Affinity purified

Immunogène: P4 HB antibody was raised using the N terminal of P4 B corresponding to a region with amino acids TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLV

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

P4HB Blocking Peptide, (ABIN5615176), is also available for use as a blocking control in assays to test for specificity of this P4HB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 B antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur P4HB

Antigène: P4HB (Prolyl 4-Hydroxylase, beta Polypeptide (P4HB))

Autre désignation: P4HB

Sujet: P4HB is the beta subunit of prolyl 4-hydroxylase, a highly abundant multifunctional enzyme that belongs to the protein disulfide isomerase family. When present as a tetramer consisting of two alpha and two beta subunits, this enzyme is involved in hydroxylation of prolyl residues in preprocollagen. This enzyme is also a disulfide isomerase containing two thioredoxin domains that catalyze the formation, breakage and rearrangement of disulfide bonds. Other known functions include its ability to act as a chaperone that inhibits aggregation of misfolded proteins in a concentration-dependent manner, its ability to bind thyroid hormone, its role in both the influx and efflux of S-nitrosothiol-bound nitric oxide, and its function as a subunit of the microsomal triglyceride transfer protein complex.

Poids moléculaire: 55 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, Cell RedoxHomeostasis, Lipid Metabolism