P4HB anticorps (N-Term)

N° du produit ABIN633962

Détail du produit anti-P4HB anticorps

Antigène: P4HB (Prolyl 4-Hydroxylase, beta Polypeptide (P4HB))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp P4HB est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: P4 HB antibody was raised against the N terminal of P4 B

Purification: Affinity purified

Immunogène: P4 HB antibody was raised using the N terminal of P4 B corresponding to a region with amino acids TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLV

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

P4HB Blocking Peptide, catalog no. 33R-9118, is also available for use as a blocking control in assays to test for specificity of this P4HB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 B antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur P4HB

Antigène: P4HB (Prolyl 4-Hydroxylase, beta Polypeptide (P4HB))

Autre désignation: P4HB (P4HB Produits)

Synonymes: anticorps DSI, anticorps ERBA2L, anticorps GIT, anticorps P4Hbeta, anticorps PDI, anticorps PDIA1, anticorps PHDB, anticorps PO4DB, anticorps PO4HB, anticorps PROHB, anticorps PDA2, anticorps PDIP, anticorps PDIR, anticorps ERp59, anticorps Pdia1, anticorps Thbp, anticorps p55, anticorps XPDIp, anticorps pdi, anticorps 1810041F13Rik, anticorps AI661267, anticorps Pdip, anticorps Pdipl, anticorps p58, anticorps prolyl 4-hydroxylase subunit beta, anticorps protein disulfide isomerase family A member 2, anticorps prolyl 4-hydroxylase, beta polypeptide, anticorps protein disulfide isomerase family A member 2 L homeolog, anticorps protein disulfide isomerase associated 2, anticorps prolyl 4-hydroxylase subunit beta L homeolog, anticorps protein disulfide-isomerase, anticorps P4HB, anticorps PDIA2, anticorps P4hb, anticorps pdia2.L, anticorps Pdia2, anticorps p4hb.L, anticorps LOC8281065

Sujet: P4HB is the beta subunit of prolyl 4-hydroxylase, a highly abundant multifunctional enzyme that belongs to the protein disulfide isomerase family. When present as a tetramer consisting of two alpha and two beta subunits, this enzyme is involved in hydroxylation of prolyl residues in preprocollagen. This enzyme is also a disulfide isomerase containing two thioredoxin domains that catalyze the formation, breakage and rearrangement of disulfide bonds. Other known functions include its ability to act as a chaperone that inhibits aggregation of misfolded proteins in a concentration-dependent manner, its ability to bind thyroid hormone, its role in both the influx and efflux of S-nitrosothiol-bound nitric oxide, and its function as a subunit of the microsomal triglyceride transfer protein complex.

Poids moléculaire: 55 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, Cell RedoxHomeostasis, Lipid Metabolism