PAI1 anticorps (N-Term)

N° du produit ABIN633986

L’anticorps Lapin Polyclonal anti-PAI1 a été validé pour WB. Il convient pour détecter PAI1 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PAI1 anticorps (N-Term) (ABIN633986)

Antigène: PAI1 (SERPINE1) (Plasminogen Activator Inhibitor 1 (SERPINE1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PAI1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PAI1 anticorps

Épitope: N-Term

Specificité: SERPINE1 antibody was raised against the N terminal of SERPINE1

Purification: Affinity purified

Immunogène: SERPINE1 antibody was raised using the N terminal of SERPINE1 corresponding to a region with amino acids VAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SERPINE1 Blocking Peptide, (ABIN5616071), is also available for use as a blocking control in assays to test for specificity of this SERPINE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PAI1

Antigène: PAI1 (SERPINE1) (Plasminogen Activator Inhibitor 1 (SERPINE1))

Autre désignation: SERPINE1

Sujet: SERPINE1 acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.

Poids moléculaire: 43 kDa (MW of target protein)

Pathways: Signalisation p53, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Autophagy, Smooth Muscle Cell Migration