APOA4 anticorps (C-Term)

N° du produit ABIN634002

Cet anticorps anti-APOA4 Polyclonal Lapin (ABIN634002) détecte spécifiquement APOA4 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour APOA4 anticorps (C-Term) (ABIN634002)

Antigène: APOA4 (Apolipoprotein A-IV (APOA4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APOA4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-APOA4 anticorps

Épitope: C-Term

Specificité: ApoA-IV antibody was raised against the C terminal of APOA4

Purification: Affinity purified

Immunogène: ApoA-IV antibody was raised using the C terminal of APOA4 corresponding to a region with amino acids RQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ApoA-IV Blocking Peptide, (ABIN5612111), is also available for use as a blocking control in assays to test for specificity of this ApoA-IV antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur APOA4

Antigène: APOA4 (Apolipoprotein A-IV (APOA4))

Autre désignation: ApoA-IV

Sujet: The gene encoding APOA4 protein contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro.

Poids moléculaire: 43 kDa (MW of target protein)

Pathways: Lipid Metabolism