IFNA7 anticorps (N-Term)

N° du produit ABIN634003

Cet anticorps Lapin Polyclonal détecte spécifiquement IFNA7 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour IFNA7 anticorps (N-Term) (ABIN634003)

Antigène: IFNA7 (IFNa7) (Interferon, alpha 7 (IFNa7))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IFNA7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IFNA7 anticorps

Épitope: N-Term

Specificité: IFN Alpha 7 antibody was raised against the N terminal of IFNA7

Purification: Affinity purified

Immunogène: IFN Alpha 7 antibody was raised using the N terminal of IFNA7 corresponding to a region with amino acids RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IFN Alpha 7 Blocking Peptide, (ABIN5614146), is also available for use as a blocking control in assays to test for specificity of this IFN Alpha 7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFNA7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IFNA7

Antigène: IFNA7 (IFNa7) (Interferon, alpha 7 (IFNa7))

Autre désignation: IFN alpha 7

Sujet: IFNA7 belongs to the alpha/beta interferon family. IFNA7 is produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT, Hepatitis C