PDIA6 anticorps (N-Term)
-
- Antigène Voir toutes PDIA6 Anticorps
- PDIA6 (Protein Disulfide Isomerase Family A, Member 6 (PDIA6))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PDIA6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PDIA6 antibody was raised against the N terminal of PDIA6
- Purification
- Affinity purified
- Immunogène
- PDIA6 antibody was raised using the N terminal of PDIA6 corresponding to a region with amino acids KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS
- Top Product
- Discover our top product PDIA6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PDIA6 Blocking Peptide, catalog no. 33R-4571, is also available for use as a blocking control in assays to test for specificity of this PDIA6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDIA6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PDIA6 (Protein Disulfide Isomerase Family A, Member 6 (PDIA6))
- Autre désignation
- PDIA6 (PDIA6 Produits)
- Synonymes
- anticorps 1700015E05Rik, anticorps AL023058, anticorps C77895, anticorps CaBP5, anticorps P5, anticorps Txndc7, anticorps ERP5, anticorps TXNDC7, anticorps CaBP1, anticorps pdi-p5, anticorps erp5, anticorps pdia6, anticorps pdip5, anticorps txndc7, anticorps protein disulfide isomerase family A member 6, anticorps protein disulfide isomerase associated 6, anticorps protein disulfide isomerase family A, member 6, anticorps protein disulfide isomerase family A member 6 L homeolog, anticorps PDIA6, anticorps Pdia6, anticorps pdia6.L
- Sujet
- Protein disulfide isomerases, such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins.
- Poids moléculaire
- 48 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling, Cell RedoxHomeostasis
-