GLA anticorps (N-Term)

N° du produit ABIN634024

Détail du produit anti-GLA anticorps

Antigène: GLA (Galactosidase, alpha (GLA))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLA est non-conjugé

Application: Western Blotting (WB)

Specificité: GLA antibody was raised against the N terminal of GLA

Purification: Affinity purified

Immunogène: GLA antibody was raised using the N terminal of GLA corresponding to a region with amino acids PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLA Blocking Peptide, catalog no. 33R-7310, is also available for use as a blocking control in assays to test for specificity of this GLA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GLA

Antigène: GLA (Galactosidase, alpha (GLA))

Autre désignation: GLA (GLA Produits)

Synonymes: anticorps GALA, anticorps Ags, anticorps zgc:101584, anticorps MGC130872, anticorps SMU.877, anticorps SCF11.21, anticorps AO090005000217, anticorps alpha-GAL, anticorps galactosidase alpha, anticorps galactosidase, alpha, anticorps galactosidase alpha S homeolog, anticorps alpha-galactosidase, anticorps aga, anticorps alpha-galactosidase A, anticorps GLA, anticorps Gla, anticorps gla, anticorps gla.S, anticorps agaN, anticorps aga, anticorps agaL, anticorps SCO0541, anticorps rafA, anticorps melA, anticorps galA, anticorps ANI_1_2528074, anticorps ANI_1_1502124, anticorps AOR_1_390174, anticorps CpipJ_CPIJ002066, anticorps MCYG_00962, anticorps MCYG_00791, anticorps Tsp_02909, anticorps Tsp_02508

Sujet: GLA is a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome