RFC3 anticorps

N° du produit ABIN634080

Cet anticorps anti-RFC3 Polyclonal Lapin (ABIN634080) détecte spécifiquement RFC3 dans WB. L’anticorps est réactif avec des échantillons de Humain et Chien.

Aperçu rapide pour RFC3 anticorps (ABIN634080)

Antigène: RFC3 (Replication Factor C (Activator 1) 3, 38kDa (RFC3))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RFC3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RFC3 anticorps

Purification: Affinity purified

Immunogène: RFC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids YHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RFC3 Blocking Peptide, (ABIN936090), is also available for use as a blocking control in assays to test for specificity of this RFC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RFC3

Antigène: RFC3 (Replication Factor C (Activator 1) 3, 38kDa (RFC3))

Autre désignation: RFC3

Sujet: The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. RFC3 is the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Telomere Maintenance, Réparation de l'ADN, DNA Replication, Synthesis of DNA