MAPK4 anticorps (Middle Region)

N° du produit ABIN634082

Détail du produit anti-MAPK4 anticorps

Antigène: MAPK4 (Mitogen-Activated Protein Kinase 4 (MAPK4))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAPK4 est non-conjugé

Application: Western Blotting (WB)

Specificité: MAPK4 antibody was raised against the middle region of MAPK4

Purification: Affinity purified

Immunogène: MAPK4 antibody was raised using the middle region of MAPK4 corresponding to a region with amino acids DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAPK4 Blocking Peptide, catalog no. 33R-1930, is also available for use as a blocking control in assays to test for specificity of this MAPK4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAPK4

Antigène: MAPK4 (Mitogen-Activated Protein Kinase 4 (MAPK4))

Autre désignation: MAPK4 (MAPK4 Produits)

Synonymes: anticorps ERK-4, anticorps ERK3, anticorps Erk4, anticorps MAPK 4, anticorps PRKM4, anticorps p63MAPK, anticorps A330097D03Rik, anticorps Erk3, anticorps Prkm4, anticorps p63Mapk, anticorps erk4, anticorps wu:fi27d11, anticorps zgc:55498, anticorps ATMPK4, anticorps F2N1.1, anticorps F2N1_1, anticorps MAP kinase 4, anticorps mitogen-activated protein kinase 4, anticorps MAP kinase 4, anticorps MAPK4, anticorps Mapk4, anticorps mapk4, anticorps MPK4

Sujet: Mitogen-activated protein kinase 4 is a member of the mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases which then translocate into the nucleus where it phosphorylates nuclear targets.

Poids moléculaire: 66 kDa (MW of target protein)

Pathways: Signalisation MAPK