CHAF1B anticorps

N° du produit ABIN634083

Détail du produit anti-CHAF1B anticorps

Antigène: CHAF1B (Chromatin Assembly Factor 1, Subunit B (p60) (CHAF1B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHAF1B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CHAF1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHAF1B Blocking Peptide, catalog no. 33R-4709, is also available for use as a blocking control in assays to test for specificity of this CHAF1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHAF1B

Antigène: CHAF1B (Chromatin Assembly Factor 1, Subunit B (p60) (CHAF1B))

Autre désignation: CHAF1B (CHAF1B Produits)

Synonymes: anticorps CHAF1B, anticorps wu:fd07c09, anticorps wu:fe36g06, anticorps wu:fv38g09, anticorps zgc:56096, anticorps CAF-1, anticorps CAF-IP60, anticorps CAF1, anticorps CAF1A, anticorps CAF1P60, anticorps MPHOSPH7, anticorps MPP7, anticorps 2600017H24Rik, anticorps C76145, anticorps CAF-I p60, anticorps CAF-Ip60, anticorps caf-1, anticorps CAF-1P60, anticorps chromatin assembly factor 1 subunit B, anticorps chromatin assembly factor 1, subunit B, anticorps chromatin assembly factor 1, subunit B (p60), anticorps chromatin assembly factor 1 subunit B L homeolog, anticorps CHAF1B, anticorps chaf1b, anticorps Chaf1b, anticorps chaf1b.L

Sujet: Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. CHAF1B corresponds to the p60 subunit and is required for chromatin assembly after replication. CHAF1B is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair.

Poids moléculaire: 61 kDa (MW of target protein)