POLK anticorps

N° du produit ABIN634096

Cet anticorps Lapin Polyclonal détecte spécifiquement POLK dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour POLK anticorps (ABIN634096)

Antigène: POLK (Polymerase (DNA Directed) kappa (POLK))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLK est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-POLK anticorps

Purification: Affinity purified

Immunogène: POLK antibody was raised using a synthetic peptide corresponding to a region with amino acids ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POLK Blocking Peptide, (ABIN936939), is also available for use as a blocking control in assays to test for specificity of this POLK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POLK

Antigène: POLK (Polymerase (DNA Directed) kappa (POLK))

Autre désignation: POLK

Sujet: POLK belongs to the DNA polymerase type-Y family. It contains 2 Rad18-type zinc fingers and 1 umuC domain. POLK is a DNA polymerase specifically involved in DNA repair. It plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls.

Poids moléculaire: 99 kDa (MW of target protein)

Pathways: Réparation de l'ADN