HERC5 anticorps (N-Term)

N° du produit ABIN634097

L’anticorps Lapin Polyclonal anti-HERC5 a été validé pour WB. Il convient pour détecter HERC5 dans des échantillons de Humain.

Aperçu rapide pour HERC5 anticorps (N-Term) (ABIN634097)

Antigène: HERC5 (Hect Domain and RLD 5 (HERC5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HERC5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HERC5 anticorps

Épitope: N-Term

Specificité: HERC5 antibody was raised against the N terminal of HERC5

Purification: Affinity purified

Immunogène: HERC5 antibody was raised using the N terminal of HERC5 corresponding to a region with amino acids CLVAELVGYRVTQIACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HERC5 Blocking Peptide, (ABIN937135), is also available for use as a blocking control in assays to test for specificity of this HERC5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HERC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HERC5

Antigène: HERC5 (Hect Domain and RLD 5 (HERC5))

Autre désignation: HERC5

Sujet: HERC5 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.

Poids moléculaire: 117 kDa (MW of target protein)