RPA1 anticorps (Middle Region)

N° du produit ABIN634118

L’anticorps anti-RPA1 Polyclonal Lapin est utilisé pour la détection de RPA1 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour RPA1 anticorps (Middle Region) (ABIN634118)

Antigène: RPA1 (Replication Protein A1, 70kDa (RPA1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPA1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RPA1 anticorps

Épitope: Middle Region

Specificité: RPA1 antibody was raised against the middle region of RPA1

Purification: Affinity purified

Immunogène: RPA1 antibody was raised using the middle region of RPA1 corresponding to a region with amino acids SRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPA1 Blocking Peptide, (ABIN5615927), is also available for use as a blocking control in assays to test for specificity of this RPA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPA1

Antigène: RPA1 (Replication Protein A1, 70kDa (RPA1))

Autre désignation: RPA1

Sujet: RPA1 plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair.

Poids moléculaire: 68 kDa (MW of target protein)

Pathways: Telomere Maintenance, Réparation de l'ADN, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA