RMI1 anticorps

N° du produit ABIN634128

Cet anticorps anti-RMI1 est un anticorps Lapin Polyclonal détectant RMI1 dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour RMI1 anticorps (ABIN634128)

Antigène: RMI1 (Homolog of Yeast RecQ-mediated Genome Instability 1 (RMI1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RMI1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RMI1 anticorps

Purification: Affinity purified

Immunogène: RMI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RMI1 Blocking Peptide, (ABIN937339), is also available for use as a blocking control in assays to test for specificity of this RMI1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RMI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RMI1

Antigène: RMI1 (Homolog of Yeast RecQ-mediated Genome Instability 1 (RMI1))

Autre désignation: RMI1

Sujet: RMI1 is an essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates to limit DNA crossover formation in cells. RMI1 promotes TOP3A binding to double Holliday junctions (DHJ) and hence stimulates TOP3A-mediated dissolution. RMI1 is required for BLM phosphorylation during mitosis. Within the BLM complex, RMI1 is required for BLM and TOP3A stability.

Poids moléculaire: 70 kDa (MW of target protein)

Pathways: Réparation de l'ADN