RMI1 anticorps

N° du produit ABIN634128

Détail du produit anti-RMI1 anticorps

Antigène: RMI1 (Homolog of Yeast RecQ-mediated Genome Instability 1 (RMI1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RMI1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RMI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RMI1 Blocking Peptide, catalog no. 33R-1953, is also available for use as a blocking control in assays to test for specificity of this RMI1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RMI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RMI1

Antigène: RMI1 (Homolog of Yeast RecQ-mediated Genome Instability 1 (RMI1))

Autre désignation: RMI1 (RMI1 Produits)

Synonymes: anticorps BLAP75, anticorps C9orf76, anticorps FAAP75, anticorps RP11-346I8.1, anticorps RGD1310671, anticorps 4932432N11Rik, anticorps C79893, anticorps MGC55882, anticorps zgc:55882, anticorps RecQ mediated genome instability 1, anticorps RecQ mediated genome instability 1 L homeolog, anticorps RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae), anticorps RMI1, anticorps Rmi1, anticorps rmi1.L, anticorps rmi1

Sujet: RMI1 is an essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates to limit DNA crossover formation in cells. RMI1 promotes TOP3A binding to double Holliday junctions (DHJ) and hence stimulates TOP3A-mediated dissolution. RMI1 is required for BLM phosphorylation during mitosis. Within the BLM complex, RMI1 is required for BLM and TOP3A stability.

Poids moléculaire: 70 kDa (MW of target protein)

Pathways: Réparation de l'ADN