KIF3B anticorps (C-Term)

N° du produit ABIN634133

Détail du produit anti-KIF3B anticorps

Antigène: KIF3B (Kinesin Family Member 3B (KIF3B))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIF3B est non-conjugé

Application: Western Blotting (WB)

Specificité: KIF3 B antibody was raised against the C terminal of KIF3

Purification: Affinity purified

Immunogène: KIF3 B antibody was raised using the C terminal of KIF3 corresponding to a region with amino acids APKVQAALDAALQDEDEIQVDASSFESTANKKSKARPKSGRKSGSSSSSS

Information d'application

Indications d'application: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIF3B Blocking Peptide, catalog no. 33R-1426, is also available for use as a blocking control in assays to test for specificity of this KIF3B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIF3B

Antigène: KIF3B (Kinesin Family Member 3B (KIF3B))

Autre désignation: KIF3B (KIF3B Produits)

Synonymes: anticorps FLA8, anticorps HH0048, anticorps KLP-11, anticorps AI854312, anticorps AW549267, anticorps mKIAA0359, anticorps kinesin family member 3B, anticorps KIF3B, anticorps Kif3b

Sujet: The protein encoded by the KIF3B gene acts as a heterodimer with kinesin family member 3A to aid in chromosome movement during mitosis and meiosis. The encoded protein is a plus end-directed microtubule motor and can interact with the SMC3 subunit of the cohesin complex. In addition, the encoded protein may be involved in the intracellular movement of membranous organelles. This protein and kinesin family member 3A form the kinesin II subfamily of the kinesin superfamily.

Poids moléculaire: 85 kDa (MW of target protein)

Pathways: Signalisation Hedgehog, M Phase