ANAPC10 anticorps (N-Term)

N° du produit ABIN634189

Détail du produit anti-ANAPC10 anticorps

Antigène: ANAPC10 (Anaphase Promoting Complex Subunit 10 (ANAPC10))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANAPC10 est non-conjugé

Application: Western Blotting (WB)

Specificité: ANAPC10 antibody was raised against the N terminal of ANAPC10

Purification: Affinity purified

Immunogène: ANAPC10 antibody was raised using the N terminal of ANAPC10 corresponding to a region with amino acids MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANAPC10 Blocking Peptide, catalog no. 33R-6569, is also available for use as a blocking control in assays to test for specificity of this ANAPC10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANAPC10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANAPC10

Antigène: ANAPC10 (Anaphase Promoting Complex Subunit 10 (ANAPC10))

Autre désignation: ANAPC10 (ANAPC10 Produits)

Synonymes: anticorps APC10, anticorps DOC1, anticorps 1500026N15Rik, anticorps A830003M23Rik, anticorps CG11419, anticorps Dmel\\CG11419, anticorps ANAPC10, anticorps SPBC1E8.06, anticorps anapc10, anticorps MGC85037, anticorps DDBDRAFT_0202332, anticorps DDBDRAFT_0235160, anticorps DDB_0202332, anticorps DDB_0235160, anticorps anaphase promoting complex subunit 10, anticorps Anaphase Promoting Complex subunit 10, anticorps anaphase promoting complex subunit DOC1, anticorps anaphase-promoting complex subunit Apc10, anticorps anaphase promoting complex subunit, anticorps predicted protein, anticorps anaphase promoting complex subunit 10 S homeolog, anticorps ANAPC10, anticorps Anapc10, anticorps APC10, anticorps DOC1, anticorps apc10, anticorps CAALFM_C107850CA, anticorps anapc10, anticorps LOC692856, anticorps anapc10.S, anticorps NAEGRDRAFT_66759

Sujet: ANAPC10 is a component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle.

Poids moléculaire: 21 kDa (MW of target protein)

Pathways: M Phase