SET/TAF-I anticorps (N-Term)

N° du produit ABIN634191

Cet anticorps anti-SET/TAF-I est un anticorps Lapin Polyclonal détectant SET/TAF-I dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour SET/TAF-I anticorps (N-Term) (ABIN634191)

Antigène: SET/TAF-I (SET) (SET Nuclear Oncogene (SET))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SET/TAF-I est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SET/TAF-I anticorps

Épitope: N-Term

Specificité: SET antibody was raised against the N terminal of SET

Purification: Affinity purified

Immunogène: SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SET Blocking Peptide, (ABIN939297), is also available for use as a blocking control in assays to test for specificity of this SET antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SET antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SET/TAF-I

Antigène: SET/TAF-I (SET) (SET Nuclear Oncogene (SET))

Autre désignation: SET

Sujet: SET is a multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone binding. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1.

Poids moléculaire: 32 kDa (MW of target protein)

Pathways: Apoptose