POLM anticorps

N° du produit ABIN634192

Cet anticorps Lapin Polyclonal détecte spécifiquement POLM dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour POLM anticorps (ABIN634192)

Antigène: POLM (Polymerase (DNA Directed), mu (POLM))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLM est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-POLM anticorps

Purification: Affinity purified

Immunogène: POLM antibody was raised using a synthetic peptide corresponding to a region with amino acids LRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POLM Blocking Peptide, (ABIN5615459), is also available for use as a blocking control in assays to test for specificity of this POLM antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POLM

Antigène: POLM (Polymerase (DNA Directed), mu (POLM))

Autre désignation: POLM

Sujet: POLM seems to act as an Ig mutase which is responsible for immunoglobulin (Ig) gene hypermutation.

Poids moléculaire: 55 kDa (MW of target protein)

Pathways: Réparation de l'ADN, Production of Molecular Mediator of Immune Response