HSPA2 anticorps (Middle Region)

N° du produit ABIN634202

Détail du produit anti-HSPA2 anticorps

Antigène: HSPA2 (Heat Shock 70kDa Protein 2 (HSPA2))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSPA2 est non-conjugé

Application: Western Blotting (WB)

Specificité: HSPA2 antibody was raised against the middle region of HSPA2

Purification: Affinity purified

Immunogène: HSPA2 antibody was raised using the middle region of HSPA2 corresponding to a region with amino acids ITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSPA2 Blocking Peptide, catalog no. 33R-4180, is also available for use as a blocking control in assays to test for specificity of this HSPA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HSPA2

Antigène: HSPA2 (Heat Shock 70kDa Protein 2 (HSPA2))

Autre désignation: HSPA2 (HSPA2 Produits)

Synonymes: anticorps HSP70-2, anticorps HSP70-3, anticorps HSPA2, anticorps DKFZp468B217, anticorps 70kDa, anticorps HSP70.2, anticorps HSP70A2, anticorps Hsp70-2, anticorps Hspt70, anticorps Hst70, anticorps HSPA3, anticorps heat shock protein family A (Hsp70) member 2, anticorps heat shock protein Hsp20, anticorps heat shock 70kDa protein 2, anticorps heat shock protein 2, anticorps heat shock protein family A member 2, anticorps HSPA2, anticorps hspA2, anticorps Hspa2

Sujet: HSPA2 belongs to the heat shock protein 70 family. In cooperation with other chaperones, HSPA2 stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognise nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.

Poids moléculaire: 70 kDa (MW of target protein)