POLL anticorps

N° du produit ABIN634210

Cet anticorps Lapin Polyclonal détecte spécifiquement POLL dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour POLL anticorps (ABIN634210)

Antigène: POLL (Polymerase (DNA Directed), lambda (POLL))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLL est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-POLL anticorps

Purification: Affinity purified

Immunogène: POLL antibody was raised using a synthetic peptide corresponding to a region with amino acids SLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POLL Blocking Peptide, (ABIN5615458), is also available for use as a blocking control in assays to test for specificity of this POLL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POLL

Antigène: POLL (Polymerase (DNA Directed), lambda (POLL))

Autre désignation: POLL

Sujet: POLL is a repair polymerase.It is involved in base excision repair (BER) responsible for repair of lesions that give rise to abasic (AP) sites in DNA. Has both DNA polymerase and terminal transferase activities. Has a 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity.

Poids moléculaire: 63 kDa (MW of target protein)

Pathways: Réparation de l'ADN, Production of Molecular Mediator of Immune Response