DKC1 anticorps (N-Term)

N° du produit ABIN634217

L’anticorps Lapin Polyclonal anti-DKC1 a été validé pour WB. Il convient pour détecter DKC1 dans des échantillons de Humain.

Aperçu rapide pour DKC1 anticorps (N-Term) (ABIN634217)

Antigène: DKC1 (Dyskeratosis Congenita 1, Dyskerin (DKC1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DKC1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DKC1 anticorps

Épitope: N-Term

Specificité: DKC1 antibody was raised against the N terminal of DKC1

Purification: Affinity purified

Immunogène: DKC1 antibody was raised using the N terminal of DKC1 corresponding to a region with amino acids EFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DKC1 Blocking Peptide, (ABIN937793), is also available for use as a blocking control in assays to test for specificity of this DKC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DKC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DKC1

Antigène: DKC1 (Dyskeratosis Congenita 1, Dyskerin (DKC1))

Autre désignation: DKC1

Sujet: This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA.

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Telomere Maintenance