DKC1 anticorps (N-Term)

N° du produit ABIN634217

Détail du produit anti-DKC1 anticorps

Antigène: DKC1 (Dyskeratosis Congenita 1, Dyskerin (DKC1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DKC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: DKC1 antibody was raised against the N terminal of DKC1

Purification: Affinity purified

Immunogène: DKC1 antibody was raised using the N terminal of DKC1 corresponding to a region with amino acids EFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DKC1 Blocking Peptide, catalog no. 33R-2407, is also available for use as a blocking control in assays to test for specificity of this DKC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DKC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DKC1

Antigène: DKC1 (Dyskeratosis Congenita 1, Dyskerin (DKC1))

Autre désignation: DKC1 (DKC1 Produits)

Synonymes: anticorps CBF5, anticorps DKC, anticorps DKCX, anticorps NAP57, anticorps NOLA4, anticorps XAP101, anticorps dyskerin, anticorps fv62a07, anticorps wu:fa28f10, anticorps wu:fc87a02, anticorps wu:fi24a05, anticorps wu:fv62a07, anticorps zgc:110395, anticorps DKC1, anticorps cbf5, anticorps dkc, anticorps nap57, anticorps nola4, anticorps xap101, anticorps BC068171, anticorps Nap57, anticorps AtCBF5, anticorps AtNAP57, anticorps homologue of NAP57, anticorps dyskerin pseudouridine synthase 1, anticorps microRNA 664b, anticorps dyskeratosis congenita 1, dyskerin, anticorps dyskeratosis congenita 1, dyskerin L homeolog, anticorps homologue of NAP57, anticorps DKC1, anticorps MIR664B, anticorps dkc1, anticorps dkc1.L, anticorps Dkc1, anticorps NAP57

Sujet: This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA.

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Telomere Maintenance